Lineage for d1td5d_ (1td5 D:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (5 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
Pfam PF01614Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species) Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
Uniprot P16528 98-272
Domain d1td5d_: 1td5 D: [106770]
Structural genomics target
Details for d1td5d_
PDB Entry: 1td5 (more details), 2.3 Å
PDB Description: Crystal Structure of the Ligand Binding Domain of E. coli IclR.
PDB Compounds: (D:) Acetate operon repressorSCOPe Domain Sequences for d1td5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1td5d_ d.110.2.2 (D:) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
SCOPe Domain Coordinates for d1td5d_:
Click to download the PDB-style file with coordinates for d1td5d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1td5d_:
- d1td5d_ first appeared in SCOP 1.69
- d1td5d_ appears in SCOPe 2.04
- d1td5d_ is called d1td5d1 in SCOPe 2.06
- d1td5d_ appears in the current release, SCOPe 2.08, called d1td5d1
View in 3D
