Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
Domain d1tcrb1: 1tcr B:1-117 [20630] Other proteins in same PDB: d1tcra2, d1tcrb2 complexed with nag, so4 |
PDB Entry: 1tcr (more details), 2.5 Å
SCOPe Domain Sequences for d1tcrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcrb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle
Timeline for d1tcrb1: