Lineage for d1tcra2 (1tcr A:118-213)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein T-cell antigen receptor [49125] (7 species) 
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries) 
Domain d1tcra2: 1tcr A:118-213 [21549]
Other proteins in same PDB: d1tcra1, d1tcrb1
complexed with nag, so4
Details for d1tcra2
PDB Entry: 1tcr (more details), 2.5 Å
PDB Description: murine t-cell antigen receptor 2c clone
PDB Compounds: (A:) alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)SCOPe Domain Sequences for d1tcra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcra2 b.1.1.2 (A:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc
SCOPe Domain Coordinates for d1tcra2:
Click to download the PDB-style file with coordinates for d1tcra2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tcra2:
- d1tcra2 first appeared (with stable ids) in SCOP 1.55
- d1tcra2 appears in SCOPe 2.03
- d1tcra2 appears in SCOPe 2.05
- d1tcra2 appears in the current release, SCOPe 2.08
View in 3D
