Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [47531] (1 PDB entry) |
Domain d1tcob_: 1tco B: [17324] Other proteins in same PDB: d1tcoa_, d1tcoc_ complexed with ca, fe, fk5, myr, po4, zn |
PDB Entry: 1tco (more details), 2.5 Å
SCOPe Domain Sequences for d1tcob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcob_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Cow (Bos taurus) [TaxId: 9913]} gneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidi fdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvg nnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
Timeline for d1tcob_: