![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (12 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50981] (20 PDB entries) |
![]() | Domain d1tbga_: 1tbg A: [27649] Other proteins in same PDB: d1tbge_, d1tbgf_, d1tbgg_, d1tbgh_ |
PDB Entry: 1tbg (more details), 2.1 Å
SCOPe Domain Sequences for d1tbga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya mhwgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d1tbga_: