Lineage for d1t9fa_ (1t9f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791607Superfamily b.42.6: MIR domain [82109] (3 families) (S)
  5. 1791608Family b.42.6.1: MIR domain [82110] (2 proteins)
    Pfam PF02815
  6. 1791609Protein Hypothetical protein R12E2.13 (1D10) [110205] (1 species)
  7. 1791610Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110206] (1 PDB entry)
    Uniprot O61793
  8. 1791611Domain d1t9fa_: 1t9f A: [106710]
    Structural genomics target
    complexed with mli

Details for d1t9fa_

PDB Entry: 1t9f (more details), 2 Å

PDB Description: Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function
PDB Compounds: (A:) protein 1d10

SCOPe Domain Sequences for d1t9fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gsdedfvtcysvlkfinandgsrlhshdvkygsgsgqqsvtavknsddinshwqifpaln
akcnrgdaikcgdkirlkhlttgtflhshhftaplskqhqevsafgseaesdtgddwtvi
cngdewleseqfklrhavtgsylslsgqqfgrpihgqrevvgtdsitggsawkvaegi

SCOPe Domain Coordinates for d1t9fa_:

Click to download the PDB-style file with coordinates for d1t9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1t9fa_: