Lineage for d1t8qb_ (1t8q B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685559Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 685598Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (4 proteins)
    Pfam PF03009
  6. 685599Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)
  7. 685600Species Escherichia coli [TaxId:562] [110383] (2 PDB entries)
  8. 685604Domain d1t8qb_: 1t8q B: [106670]

Details for d1t8qb_

PDB Entry: 1t8q (more details), 2 Å

PDB Description: Structural genomics, Crystal structure of Glycerophosphoryl diester phosphodiesterase from E. coli
PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase, periplasmic

SCOP Domain Sequences for d1t8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8qb_ c.1.18.3 (B:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]}
nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
qlydalynkagvnglftdfpdkavkflnk

SCOP Domain Coordinates for d1t8qb_:

Click to download the PDB-style file with coordinates for d1t8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1t8qb_: