Lineage for d1t8pa_ (1t8p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2890977Protein Phosphoglycerate mutase [53256] (6 species)
  7. 2891008Species Human (Homo sapiens) [TaxId:9606] [110656] (1 PDB entry)
    Uniprot P07738
  8. 2891009Domain d1t8pa_: 1t8p A: [106667]

Details for d1t8pa_

PDB Entry: 1t8p (more details), 2.5 Å

PDB Description: Crystal structure of Human erythrocyte 2,3-bisphosphoglycerate mutase
PDB Compounds: (A:) Bisphosphoglycerate mutase

SCOPe Domain Sequences for d1t8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8pa_ c.60.1.1 (A:) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]}
skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
qaaikkved

SCOPe Domain Coordinates for d1t8pa_:

Click to download the PDB-style file with coordinates for d1t8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1t8pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t8pb_