Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143958] (10 PDB entries) Uniprot P06734 156-298 |
Domain d1t8da1: 1t8d A:1-143 [119171] automatically matched to 1T8C A:1-143 |
PDB Entry: 1t8d (more details)
SCOPe Domain Sequences for d1t8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdr klgawvcdrlatctppasegsae
Timeline for d1t8da1: