Lineage for d1t8ca1 (1t8c A:1-143)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682170Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 1682171Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
    Uniprot P06734 156-298
  8. 1682222Domain d1t8ca1: 1t8c A:1-143 [119170]

Details for d1t8ca1

PDB Entry: 1t8c (more details)

PDB Description: structure of the c-type lectin domain of cd23
PDB Compounds: (A:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d1t8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ca1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdr
klgawvcdrlatctppasegsae

SCOPe Domain Coordinates for d1t8ca1:

Click to download the PDB-style file with coordinates for d1t8ca1.
(The format of our PDB-style files is described here.)

Timeline for d1t8ca1: