Lineage for d1t56a2 (1t56 A:95-214)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502122Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1502123Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1502124Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1502131Protein Ethr repressor [109978] (1 species)
  7. 1502132Species Mycobacterium tuberculosis [TaxId:1773] [109979] (14 PDB entries)
    Uniprot P96222 22-215
  8. 1502135Domain d1t56a2: 1t56 A:95-214 [106429]
    Other proteins in same PDB: d1t56a1
    complexed with dio, gol

Details for d1t56a2

PDB Entry: 1t56 (more details), 1.7 Å

PDB Description: Crystal structure of TetR family repressor M. tuberculosis EthR
PDB Compounds: (A:) EthR repressor

SCOPe Domain Sequences for d1t56a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t56a2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d1t56a2:

Click to download the PDB-style file with coordinates for d1t56a2.
(The format of our PDB-style files is described here.)

Timeline for d1t56a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t56a1