Lineage for d1t50a_ (1t50 A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894289Fold g.63: Mollusk pheromone [90182] (1 superfamily)
    disulfide-rich; all-alpha
  4. 894290Superfamily g.63.1: Mollusk pheromone [90183] (1 family) (S)
  5. 894291Family g.63.1.1: Mollusk pheromone [90184] (1 protein)
  6. 894292Protein Attractin [90185] (1 species)
  7. 894293Species California sea hare (Aplysia californica) [TaxId:6500] [90186] (1 PDB entry)
  8. 894294Domain d1t50a_: 1t50 A: [99124]

Details for d1t50a_

PDB Entry: 1t50 (more details)

PDB Description: nmr solution structure of aplysia attractin
PDB Compounds: (A:) Attractin

SCOP Domain Sequences for d1t50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t50a_ g.63.1.1 (A:) Attractin {California sea hare (Aplysia californica) [TaxId: 6500]}
dqncdignitsqcqmqhkncedangcdtiieecktsmvercqnqefesaagsttlgpq

SCOP Domain Coordinates for d1t50a_:

Click to download the PDB-style file with coordinates for d1t50a_.
(The format of our PDB-style files is described here.)

Timeline for d1t50a_: