Lineage for d1t3na2 (1t3n A:27-299)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) 
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all membersSuperfamily e.8.1: DNA/RNA polymerases [56672] (9 families) 
"palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
Protein DNA polymerase iota [111295] (1 species) Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries)
Uniprot Q9UNA4
Domain d1t3na2: 1t3n A:27-299 [106364]
Other proteins in same PDB: d1t3na1, d1t3nb1
protein/DNA complex; complexed with mg, ttp
Details for d1t3na2
PDB Entry: 1t3n (more details), 2.3 Å
PDB Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp
PDB Compounds: (A:) polymerase (DNA directed) iotaSCOPe Domain Sequences for d1t3na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3na2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
kilekelgisvaqriqklsfgednspvilsgpp
SCOPe Domain Coordinates for d1t3na2:
Click to download the PDB-style file with coordinates for d1t3na2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t3na2:
- d1t3na2 first appeared in SCOP 1.69
- d1t3na2 appears in SCOPe 2.07
View in 3D
