![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
![]() | Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) ![]() |
![]() | Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
![]() | Protein DNA polymerase iota [111015] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111016] (8 PDB entries) |
![]() | Domain d1t3na1: 1t3n A:300-414 [106363] Other proteins in same PDB: d1t3na2, d1t3nb2 |
PDB Entry: 1t3n (more details), 2.3 Å
SCOP Domain Sequences for d1t3na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3na1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk
Timeline for d1t3na1: