Lineage for d1t35e_ (1t35 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922908Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
    Pfam PF03641
  6. 2922939Protein Hypothetical protein YvdD [102409] (1 species)
  7. 2922940Species Bacillus subtilis [TaxId:1423] [102410] (1 PDB entry)
  8. 2922945Domain d1t35e_: 1t35 E: [99112]
    structural genomics; NYSGRC target T833
    complexed with so4

Details for d1t35e_

PDB Entry: 1t35 (more details), 2.72 Å

PDB Description: crystal structure of a hypothetical protein yvdd- a putative lysine decarboxylase
PDB Compounds: (E:) HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase

SCOPe Domain Sequences for d1t35e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t35e_ c.129.1.1 (E:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]}
mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
ypil

SCOPe Domain Coordinates for d1t35e_:

Click to download the PDB-style file with coordinates for d1t35e_.
(The format of our PDB-style files is described here.)

Timeline for d1t35e_: