Lineage for d1t2ja_ (1t2j A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758009Domain d1t2ja_: 1t2j A: [161745]
    automated match to d1vhpa_
    complexed with peg

Details for d1t2ja_

PDB Entry: 1t2j (more details), 1.5 Å

PDB Description: Crystal structure of a Human VH domain
PDB Compounds: (A:) M12-Variable Heavy domain

SCOPe Domain Sequences for d1t2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ja_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlqesggglvqpggslrlscaasgftfsnsamswvrqapgkglewvssisgsggntys
adsvkgrftisrdnaknslylqmnslraedtavyycardwygmdvwgqgttvtvss

SCOPe Domain Coordinates for d1t2ja_:

Click to download the PDB-style file with coordinates for d1t2ja_.
(The format of our PDB-style files is described here.)

Timeline for d1t2ja_: