![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein Lactate dehydrogenase [56339] (20 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (14 PDB entries) |
![]() | Domain d1t2da2: 1t2d A:151-315 [99085] Other proteins in same PDB: d1t2da1 complexed with gol, nad, oxl |
PDB Entry: 1t2d (more details), 1.1 Å
SCOPe Domain Sequences for d1t2da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala
Timeline for d1t2da2: