Lineage for d1t12a_ (1t12 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000589Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2000590Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2000591Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2000636Protein automated matches [190480] (3 species)
    not a true protein
  7. 2000645Species Tobacco (Nicotiana tabacum) [TaxId:4097] [254901] (1 PDB entry)
  8. 2000646Domain d1t12a_: 1t12 A: [240767]
    automated match to d1fk5a_

Details for d1t12a_

PDB Entry: 1t12 (more details)

PDB Description: solution structure of a new ltp1
PDB Compounds: (A:) nonspecific lipid-transfer protein 1

SCOPe Domain Sequences for d1t12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t12a_ a.52.1.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
aitcgqvtsnlapclaylrntgplgrccggvkalvnsarttedrqiactclksaagaisg
inlgkaaglpstcgvnipykispstdcskvq

SCOPe Domain Coordinates for d1t12a_:

Click to download the PDB-style file with coordinates for d1t12a_.
(The format of our PDB-style files is described here.)

Timeline for d1t12a_: