Class a: All alpha proteins [46456] (290 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
Protein automated matches [190480] (4 species) not a true protein |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [254901] (1 PDB entry) |
Domain d1t12a_: 1t12 A: [240767] automated match to d1fk5a_ |
PDB Entry: 1t12 (more details)
SCOPe Domain Sequences for d1t12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t12a_ a.52.1.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} aitcgqvtsnlapclaylrntgplgrccggvkalvnsarttedrqiactclksaagaisg inlgkaaglpstcgvnipykispstdcskvq
Timeline for d1t12a_: