Lineage for d1t0qb_ (1t0q B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
    Uniprot O87802
  8. Domain d1t0qb_: 1t0q B: [106221]
    Other proteins in same PDB: d1t0qa_, d1t0qc_
    complexed with fe, mcr, oh, so4

Details for d1t0qb_

PDB Entry: 1t0q (more details), 2.15 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase
PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d1t0qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0qb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

SCOPe Domain Coordinates for d1t0qb_ are not available.

Timeline for d1t0qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t0qa_, d1t0qc_