Lineage for d1t0qa_ (1t0q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703568Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (2 species)
    contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450)
  7. 2703581Species Pseudomonas stutzeri [TaxId:316] [109789] (6 PDB entries)
    Uniprot O87798
  8. 2703582Domain d1t0qa_: 1t0q A: [106220]
    Other proteins in same PDB: d1t0qb_, d1t0qc_
    complexed with fe, mcr, oh, so4
    has additional subdomain(s) that are not in the common domain

Details for d1t0qa_

PDB Entry: 1t0q (more details), 2.15 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase
PDB Compounds: (A:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d1t0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0qa_ a.25.1.2 (A:) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]}
smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
ahdyewvkayq

SCOPe Domain Coordinates for d1t0qa_:

Click to download the PDB-style file with coordinates for d1t0qa_.
(The format of our PDB-style files is described here.)

Timeline for d1t0qa_: