Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.76.1: GYF domain [55277] (1 family) |
Family d.76.1.1: GYF domain [55278] (2 proteins) Pfam PF02213 |
Protein GYF domain from cd2bp2 protein [55279] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries) |
Domain d1syxb1: 1syx B:25-86 [119081] Other proteins in same PDB: d1syxa_, d1syxc_, d1syxe_ automatically matched to d1gyfa_ |
PDB Entry: 1syx (more details), 2.35 Å
SCOPe Domain Sequences for d1syxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1syxb1 d.76.1.1 (B:25-86) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]} dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl yt
Timeline for d1syxb1: