Lineage for d1syqa1 (1syq A:1-128)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263535Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1263536Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1263552Protein Vinculin [47224] (2 species)
  7. 1263566Species Human (Homo sapiens) [TaxId:9606] [101111] (6 PDB entries)
    Uniprot P18206 1-257
  8. 1263573Domain d1syqa1: 1syq A:1-128 [106124]
    head domain; contains two domains of this fold; complexed with talin fragment, chain B (Uniprot Q9Y490 607-631)

Details for d1syqa1

PDB Entry: 1syq (more details), 2.42 Å

PDB Description: Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636
PDB Compounds: (A:) vinculin isoform VCL

SCOPe Domain Sequences for d1syqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syqa1 a.24.9.1 (A:1-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgke
tvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgts
dllltfde

SCOPe Domain Coordinates for d1syqa1:

Click to download the PDB-style file with coordinates for d1syqa1.
(The format of our PDB-style files is described here.)

Timeline for d1syqa1:

1263573
d1syqa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1syqa2