![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Sex-lethal protein [54938] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54939] (4 PDB entries) |
![]() | Domain d1sxla_: 1sxl A: [39180] second RNA-binding domain |
PDB Entry: 1sxl (more details)
SCOPe Domain Sequences for d1sxla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxla_ d.58.7.1 (A:) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} msyarpggesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafv rynkreeaqeaisalnnvipeggsqplsvrlaeehgk
Timeline for d1sxla_: