Lineage for d1sv8a2 (1sv8 A:240-307)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) 
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
secreted during involution
Species Sheep (Ovis aries) [TaxId:9940] [109621] (4 PDB entries) 
Domain d1sv8a2: 1sv8 A:240-307 [99020]
Other proteins in same PDB: d1sv8a1
complexed with nag
Details for d1sv8a2
PDB Entry: 1sv8 (more details), 2.8 Å
PDB Description: Crystal structure of a signaling protein from buffalo(SPB-40)at 2.8 A resolution using crystals grown in the prsence of carbohydrates
PDB Compounds: (A:) signalling protein spbSCOP Domain Sequences for d1sv8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv8a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay
SCOP Domain Coordinates for d1sv8a2:
Click to download the PDB-style file with coordinates for d1sv8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sv8a2:
- d1sv8a2 first appeared in SCOP 1.67
- d1sv8a2 appears in SCOP 1.71
- d1sv8a2 does not appear in SCOP 1.75
View in 3D
