Lineage for d1suxa_ (1sux A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (18 species) 
Species Trypanosoma cruzi [TaxId:5693] [51358] (4 PDB entries)
Uniprot P52270
Domain d1suxa_: 1sux A: [106031]
Details for d1suxa_
PDB Entry: 1sux (more details), 2 Å
PDB Description: crystallographic analysis of the complex between triosephosphate isomerase from trypanosoma cruzi and 3-(2-benzothiazolylthio)-1- propanesulfonic acid
PDB Compounds: (A:) Triosephosphate isomerase, glycosomalSCOP Domain Sequences for d1suxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suxa_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]}
askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
efveiieatk
SCOP Domain Coordinates for d1suxa_:
Click to download the PDB-style file with coordinates for d1suxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1suxa_:
- d1suxa_ first appeared in SCOP 1.69
- d1suxa_ appears in SCOP 1.73
- d1suxa_ appears in SCOPe 2.01
- d1suxa_ appears in the current release, SCOPe 2.08
View in 3D
