Lineage for d1suia1 (1sui A:21-247)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611697Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1611698Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species)
  7. 1611699Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries)
    Uniprot Q40313 21-247
  8. 1611704Domain d1suia1: 1sui A:21-247 [119049]
    complexed with ca, fre, sah

Details for d1suia1

PDB Entry: 1sui (more details), 2.7 Å

PDB Description: alfalfa caffeoyl coenzyme a 3-o-methyltransferase
PDB Compounds: (A:) Caffeoyl-CoA O-methyltransferase

SCOPe Domain Sequences for d1suia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suia1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik

SCOPe Domain Coordinates for d1suia1:

Click to download the PDB-style file with coordinates for d1suia1.
(The format of our PDB-style files is described here.)

Timeline for d1suia1: