Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily) beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a |
Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4] automatically mapped to Pfam PF05652 |
Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein) |
Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102863] (5 PDB entries) |
Domain d1st0a2: 1st0 A:38-145 [98980] Other proteins in same PDB: d1st0a1, d1st0b1 complexed with gtg, yt3 |
PDB Entry: 1st0 (more details), 1.9 Å
SCOPe Domain Sequences for d1st0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1st0a2 d.246.1.1 (A:38-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} apvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaql ltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr
Timeline for d1st0a2: