Lineage for d1st0a2 (1st0 A:38-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008663Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 3008664Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 3008665Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein)
  6. 3008666Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species)
  7. 3008667Species Human (Homo sapiens) [TaxId:9606] [102863] (5 PDB entries)
  8. 3008668Domain d1st0a2: 1st0 A:38-145 [98980]
    Other proteins in same PDB: d1st0a1, d1st0b1
    complexed with gtg, yt3

Details for d1st0a2

PDB Entry: 1st0 (more details), 1.9 Å

PDB Description: structure of dcps bound to m7gpppg
PDB Compounds: (A:) mRNA decapping enzyme

SCOPe Domain Sequences for d1st0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st0a2 d.246.1.1 (A:38-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaql
ltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d1st0a2:

Click to download the PDB-style file with coordinates for d1st0a2.
(The format of our PDB-style files is described here.)

Timeline for d1st0a2:

3008668
d1st0a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1st0a1