Lineage for d1st0a1 (1st0 A:146-337)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176031Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2176032Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2176244Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)
  6. 2176245Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)
  7. 2176246Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries)
  8. 2176249Domain d1st0a1: 1st0 A:146-337 [98979]
    Other proteins in same PDB: d1st0a2, d1st0b2
    complexed with gtg, yt3

Details for d1st0a1

PDB Entry: 1st0 (more details), 1.9 Å

PDB Description: structure of dcps bound to m7gpppg
PDB Compounds: (A:) mRNA decapping enzyme

SCOPe Domain Sequences for d1st0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st0a1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlnvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqqs

SCOPe Domain Coordinates for d1st0a1:

Click to download the PDB-style file with coordinates for d1st0a1.
(The format of our PDB-style files is described here.)

Timeline for d1st0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1st0a2