Lineage for d1ssfa1 (1ssf A:7-60)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) 
Family b.34.9.1: Tudor domain [63749] (9 proteins)
Pfam PF00567Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species)
protein duplication: contains two Tudor domains in tandemSpecies Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries)
Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
Domain d1ssfa1: 1ssf A:7-60 [105982]
Other proteins in same PDB: d1ssfa2
Details for d1ssfa1
PDB Entry: 1ssf (more details)
PDB Description: solution structure of the mouse 53bp1 fragment (residues 1463-1617)
PDB Compounds: (A:) Transformation related protein 53 binding protein 1SCOPe Domain Sequences for d1ssfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ssfa1 b.34.9.1 (A:7-60) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp
SCOPe Domain Coordinates for d1ssfa1:
Click to download the PDB-style file with coordinates for d1ssfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ssfa1:
- d1ssfa1 first appeared in SCOP 1.69
- d1ssfa1 appears in SCOPe 2.07
View in 3D
