Lineage for d1sqia1 (1sqi A:8-174)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256396] (1 PDB entry)
Uniprot P32755
Domain d1sqia1: 1sqi A:8-174 [105914]
complexed with 869, fe
Details for d1sqia1
PDB Entry: 1sqi (more details), 2.15 Å
PDB Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
PDB Compounds: (A:) 4-hydroxyphenylpyruvic acid dioxygenaseSCOPe Domain Sequences for d1sqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqia1 d.32.1.3 (A:8-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki
vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk
fgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklp
SCOPe Domain Coordinates for d1sqia1:
Click to download the PDB-style file with coordinates for d1sqia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sqia1:
- d1sqia1 first appeared in SCOP 1.69
- d1sqia1 appears in SCOPe 2.06
- d1sqia1 appears in the current release, SCOPe 2.08
View in 3D
