Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [55997] (17 PDB entries) Uniprot P31800 |
Domain d1sqba1: 1sqb A:1-233 [105890] Other proteins in same PDB: d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_ complexed with azo, fes, hem |
PDB Entry: 1sqb (more details), 2.69 Å
SCOPe Domain Sequences for d1sqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqba1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp
Timeline for d1sqba1: