Lineage for d1sq2n_ (1sq2 N:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Novel antigen receptor (against lysozyme) [110042] (1 species) Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries)
Uniprot Q8AXI4 # fragment
Domain d1sq2n_: 1sq2 N: [105881]
Other proteins in same PDB: d1sq2l_
complexed with cl, edo
Details for d1sq2n_
PDB Entry: 1sq2 (more details), 1.45 Å
PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor (NAR) Variable Domain in Complex With Lysozyme
PDB Compounds: (N:) novel antigen receptorSCOPe Domain Sequences for d1sq2n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns
gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn
SCOPe Domain Coordinates for d1sq2n_:
Click to download the PDB-style file with coordinates for d1sq2n_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sq2n_:
- d1sq2n_ first appeared in SCOP 1.69
- d1sq2n_ appears in SCOPe 2.07
View in 3D
