| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) ![]() |
| Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins) decorated with additional structure |
| Protein Subtilisin prosegment [54906] (2 species) |
| Species Bacillus amyloliquefaciens [TaxId:1390] [54907] (1 PDB entry) |
| Domain d1spbp_: 1spb P: [39068] Other proteins in same PDB: d1spbs_ CASP1 complexed with na; mutant |
PDB Entry: 1spb (more details), 2 Å
SCOPe Domain Sequences for d1spbp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spbp_ d.58.3.2 (P:) Subtilisin prosegment {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqtmstmsaakkkdvisekggkvqkqfkyvdaasatlnekavkelkkdpsva
yveedhvahay
Timeline for d1spbp_: