Lineage for d1spbp_ (1spb P:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) 
Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
decorated with additional structure
Protein Subtilisin prosegment [54906] (2 species) 
Species Bacillus amyloliquefaciens [TaxId:1390] [54907] (1 PDB entry) 
Domain d1spbp_: 1spb P: [39068]
Other proteins in same PDB: d1spbs_
CASP1
complexed with na; mutant
Details for d1spbp_
PDB Entry: 1spb (more details), 2 Å
PDB Description: subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
PDB Compounds: (P:) subtilisin bpn' prosegmentSCOPe Domain Sequences for d1spbp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spbp_ d.58.3.2 (P:) Subtilisin prosegment {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqtmstmsaakkkdvisekggkvqkqfkyvdaasatlnekavkelkkdpsva
yveedhvahay
SCOPe Domain Coordinates for d1spbp_:
Click to download the PDB-style file with coordinates for d1spbp_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1spbp_:
- d1spbp_ first appeared (with stable ids) in SCOP 1.55
- d1spbp_ appears in SCOP 1.75
- d1spbp_ appears in SCOPe 2.02
- d1spbp_ appears in the current release, SCOPe 2.08
View in 3D
