Lineage for d1so8a_ (1so8 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820673Protein Type II 3-hydroxyacyl-CoA dehydrogenase [63933] (3 species)
  7. 820674Species Human (Homo sapiens) [TaxId:9606] [102152] (3 PDB entries)
    Uniprot Q99714
  8. 820677Domain d1so8a_: 1so8 A: [98940]
    complexed with cl, na

Details for d1so8a_

PDB Entry: 1so8 (more details), 2.3 Å

PDB Description: Abeta-bound human ABAD structure [also known as 3-hydroxyacyl-CoA dehydrogenase type II (Type II HADH), Endoplasmic reticulum-associated amyloid beta-peptide binding protein (ERAB)]
PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase type II

SCOP Domain Sequences for d1so8a_:

Sequence, based on SEQRES records: (download)

>d1so8a_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
rsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadv
tsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgt
fnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiard
lapigirvmtiapglfgtplltslpekvcnflasqvpfpsrlgdpaeyahlvqaiienpf
lngevirl

Sequence, based on observed residues (ATOM records): (download)

>d1so8a_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
rsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadv
tsekdvqtalalakgkfgrvdvavncagifqrvldvnlmgtfnvirlvagemgqnepdqg
gqrgviintasvaafegqvgqaaysaskggivgmtlpiardlapigirvmtiapglfgtp
lltdpaeyahlvqaiienpflngevirl

SCOP Domain Coordinates for d1so8a_:

Click to download the PDB-style file with coordinates for d1so8a_.
(The format of our PDB-style files is described here.)

Timeline for d1so8a_: