Lineage for d1smvc_ (1smv C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141948Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 1141959Protein Sobemovirus coat protein [88644] (4 species)
  7. 1141972Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
    Uniprot Q9EB06
  8. 1141975Domain d1smvc_: 1smv C: [23290]
    complexed with ca

Details for d1smvc_

PDB Entry: 1smv (more details), 3 Å

PDB Description: primary structure of sesbania mosaic virus coat protein: its implications to the assembly and architecture of the virus
PDB Compounds: (C:) sesbania mosaic virus coat protein

SCOPe Domain Sequences for d1smvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smvc_ b.121.4.7 (C:) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
qagismapsaqgamvrirnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgt
wlrgvadnwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvs
gqvwsgsaglcfinnsrcsdtstaisttldvselgkkwypyktsadyatavgvdvniatd
lvparlvialldgssstavaagriydtytiqmieptasalnl

SCOPe Domain Coordinates for d1smvc_:

Click to download the PDB-style file with coordinates for d1smvc_.
(The format of our PDB-style files is described here.)

Timeline for d1smvc_: