Lineage for d1smla_ (1sml A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736618Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 736619Protein Zn metallo-beta-lactamase [56283] (8 species)
  7. 736680Species Xanthomonas maltophilia [TaxId:40324] [56286] (11 PDB entries)
  8. 736687Domain d1smla_: 1sml A: [42053]
    complexed with zn

Details for d1smla_

PDB Entry: 1sml (more details), 1.7 Å

PDB Description: metallo beta lactamase l1 from stenotrophomonas maltophilia
PDB Compounds: (A:) protein (penicillinase)

SCOP Domain Sequences for d1smla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smla_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOP Domain Coordinates for d1smla_:

Click to download the PDB-style file with coordinates for d1smla_.
(The format of our PDB-style files is described here.)

Timeline for d1smla_: