Lineage for d1sm4a1 (1sm4 A:67-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793554Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. 2793587Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (2 PDB entries)
  8. 2793590Domain d1sm4a1: 1sm4 A:67-207 [98913]
    Other proteins in same PDB: d1sm4a2, d1sm4b2
    complexed with fad, po4

Details for d1sm4a1

PDB Entry: 1sm4 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika
PDB Compounds: (A:) chloroplast ferredoxin-NADP+ oxidoreductase

SCOPe Domain Sequences for d1sm4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm4a1 b.43.4.2 (A:67-207) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Paprika (Capsicum annuum) [TaxId: 4072]}
iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
lkpgadvkitgpvgkemlmpk

SCOPe Domain Coordinates for d1sm4a1:

Click to download the PDB-style file with coordinates for d1sm4a1.
(The format of our PDB-style files is described here.)

Timeline for d1sm4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm4a2