Lineage for d1sm2a_ (1sm2 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
Uniprot Q08881 357-619
Domain d1sm2a_: 1sm2 A: [105754]
complexed with stu
Details for d1sm2a_
PDB Entry: 1sm2 (more details), 2.3 Å
PDB Description: Crystal structure of the phosphorylated Interleukin-2 tyrosine kinase catalytic domain
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSKSCOPe Domain Sequences for d1sm2a_:
Sequence, based on SEQRES records: (download)
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg
Sequence, based on observed residues (ATOM records): (download)
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
iaesg
SCOPe Domain Coordinates for d1sm2a_:
Click to download the PDB-style file with coordinates for d1sm2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sm2a_:
- d1sm2a_ first appeared in SCOP 1.69
- d1sm2a_ appears in SCOPe 2.07
View in 3D
