Lineage for d1skye3 (1sky E:83-356)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596277Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1596387Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1596388Species Bacillus sp., strain ps3 [TaxId:1409] [88782] (1 PDB entry)
  8. 1596389Domain d1skye3: 1sky E:83-356 [32359]
    Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye2
    complexed with so4

Details for d1skye3

PDB Entry: 1sky (more details), 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3
PDB Compounds: (E:) f1-ATPase

SCOPe Domain Sequences for d1skye3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skye3 c.37.1.11 (E:83-356) Central domain of beta subunit of F1 ATP synthase {Bacillus sp., strain ps3 [TaxId: 1409]}
isvpvgqvtlgrvfnvlgepidlegdipadarrdpihrpapkfeelateveiletgikvv
dllapyikggkiglfggagvgktvliqelihniaqehggisvfagvgertregndlyhem
kdsgvisktamvfgqmneppgarmrvaltgltmaeyfrdeqgqdgllfidnifrftqags
evsallgrmpsaigyqptlatemgqlqeritstakgsitsiqaiyvpaddytdpapattf
shldattnlerklaemgiypavdplvstsralap

SCOPe Domain Coordinates for d1skye3:

Click to download the PDB-style file with coordinates for d1skye3.
(The format of our PDB-style files is described here.)

Timeline for d1skye3: