Lineage for d1siwa1 (1siw A:1075-1243)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
Superfamily b.52.2: ADC-like [50692] (4 families) 
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
molybdopterine enzyme
Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species) Species Escherichia coli [TaxId:562] [101829] (7 PDB entries)
Uniprot P09152
Domain d1siwa1: 1siw A:1075-1243 [105589]
Other proteins in same PDB: d1siwa2, d1siwb_, d1siwc_
complexed with 3ph, f3s, gdp, hem, sf4
Details for d1siwa1
PDB Entry: 1siw (more details), 2.2 Å
PDB Description: crystal structure of the apomolybdo-narghi
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chainSCOPe Domain Sequences for d1siwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1siwa1 b.52.2.2 (A:1075-1243) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqe
SCOPe Domain Coordinates for d1siwa1:
Click to download the PDB-style file with coordinates for d1siwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1siwa1:
- d1siwa1 first appeared in SCOP 1.69
- d1siwa1 appears in SCOPe 2.05
- d1siwa1 appears in SCOPe 2.07
- d1siwa1 appears in the current release, SCOPe 2.08
View in 3D
