![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
![]() | Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109795] (3 PDB entries) Uniprot Q92947 |
![]() | Domain d1siqa1: 1siq A:239-392 [105585] Other proteins in same PDB: d1siqa2 complexed with fad |
PDB Entry: 1siq (more details), 2.1 Å
SCOPe Domain Sequences for d1siqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir hamnleavntyegthdihalilgraitgiqafta
Timeline for d1siqa1: