Lineage for d1shsa_ (1shs A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529991Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529992Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1529993Family b.15.1.1: HSP20 [49765] (1 protein)
  6. 1529994Protein Small heat shock protein [49766] (2 species)
  7. 1529995Species Methanococcus jannaschii [TaxId:2190] [49767] (3 PDB entries)
  8. 1530006Domain d1shsa_: 1shs A: [23675]

Details for d1shsa_

PDB Entry: 1shs (more details), 2.9 Å

PDB Description: small heat shock protein from methanococcus jannaschii
PDB Compounds: (A:) small heat shock protein

SCOPe Domain Sequences for d1shsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Methanococcus jannaschii [TaxId: 2190]}
tgiqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmitese
riiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie

SCOPe Domain Coordinates for d1shsa_:

Click to download the PDB-style file with coordinates for d1shsa_.
(The format of our PDB-style files is described here.)

Timeline for d1shsa_: