Lineage for d1sgja_ (1sgj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100234Family c.1.12.5: HpcH/HpaI aldolase [51638] (3 proteins)
    forms a swapped dimer; contains a PK-type metal-binding site
  6. 2100241Protein Citrate lyase, beta subunit [110375] (2 species)
    non-swapped trimer
  7. 2100242Species Deinococcus radiodurans [TaxId:1299] [110376] (1 PDB entry)
    Uniprot Q9RUZ0 4-234
  8. 2100243Domain d1sgja_: 1sgj A: [105535]
    complexed with mg, oaa

Details for d1sgja_

PDB Entry: 1sgj (more details), 1.84 Å

PDB Description: crystal structure of citrate lyase beta subunit
PDB Compounds: (A:) citrate lyase, beta subunit

SCOPe Domain Sequences for d1sgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgja_ c.1.12.5 (A:) Citrate lyase, beta subunit {Deinococcus radiodurans [TaxId: 1299]}
ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg

SCOPe Domain Coordinates for d1sgja_:

Click to download the PDB-style file with coordinates for d1sgja_.
(The format of our PDB-style files is described here.)

Timeline for d1sgja_: