Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein 7S NGF protease subunits [50559] (1 species) two pairs of homologous but non-identical chains |
Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry) |
Domain d1sgfg_: 1sgf G: [26309] Other proteins in same PDB: d1sgfb_, d1sgfy_ complexed with nag, zn |
PDB Entry: 1sgf (more details), 3.15 Å
SCOPe Domain Sequences for d1sgfg_:
Sequence, based on SEQRES records: (download)
>d1sgfg_ b.47.1.2 (G:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde psaqhrfvskaiphpgfnmslmrkhirfleydysndlmllrlskpaditdtvkpitlpte epklgstclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdg gkdtckgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp
>d1sgfg_ b.47.1.2 (G:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde psaqhrfvskaiphpgfnmslmfleydysndlmllrlskpaditdtvkpitlpteepklg stclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdggkdtc kgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp
Timeline for d1sgfg_: