Lineage for d1sg9a_ (1sg9 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612481Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 proteins)
  6. 1612482Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 1612486Species Thermotoga maritima [TaxId:2336] [89745] (3 PDB entries)
    Uniprot Q9WYV8
  8. 1612489Domain d1sg9a_: 1sg9 A: [105526]
    Structural genomics target
    complexed with gln, sam

Details for d1sg9a_

PDB Entry: 1sg9 (more details), 2.3 Å

PDB Description: crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase
PDB Compounds: (A:) hemK protein

SCOPe Domain Sequences for d1sg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg9a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}
sgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekril
elvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvad
igtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkek
fasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmei
gedqveelkkivsdtvflkdsagkyrflllnrrs

SCOPe Domain Coordinates for d1sg9a_:

Click to download the PDB-style file with coordinates for d1sg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1sg9a_: