Lineage for d1sg1x1 (1sg1 X:2-56)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 3034708Protein Low affinity neurotrophin receptor p75NTR, domain 1 [419062] (1 species)
  7. 3034709Species Norway rat (Rattus norvegicus) [TaxId:10116] [419553] (2 PDB entries)
    Uniprot P07174 31-190 ; species # fragment contains 3 complete and 1 partial (C-terminal) 'domains'
  8. 3034710Domain d1sg1x1: 1sg1 X:2-56 [105515]
    Other proteins in same PDB: d1sg1a_, d1sg1b_, d1sg1x2, d1sg1x3, d1sg1x4
    complexed with cl
    has additional secondary structure elements or disulfide bonds beyond those in the common domain

Details for d1sg1x1

PDB Entry: 1sg1 (more details), 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75
PDB Compounds: (X:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d1sg1x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg1x1 g.24.1.1 (X:2-56) Low affinity neurotrophin receptor p75NTR, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etcstglythsgecckacnlgegvaqpcganqtvcepcldnvtfsdvvsatepck

SCOPe Domain Coordinates for d1sg1x1:

Click to download the PDB-style file with coordinates for d1sg1x1.
(The format of our PDB-style files is described here.)

Timeline for d1sg1x1: