Lineage for d1sfka_ (1sfk A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) (S)
    automatically mapped to Pfam PF01003
  5. Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. Protein Flavivirus capsid protein C [101259] (3 species)
  7. Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry)
    Uniprot P14335 23-98
  8. Domain d1sfka_: 1sfk A: [105488]
    complexed with ca, cl, pg4, po4

Details for d1sfka_

PDB Entry: 1sfk (more details), 3.2 Å

PDB Description: Core (C) protein from West Nile Virus, subtype Kunjin
PDB Compounds: (A:) Core protein

SCOPe Domain Sequences for d1sfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfka_ a.190.1.1 (A:) Flavivirus capsid protein C {Kunjin virus [TaxId: 11077]}
lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
kkelgtltsainr

SCOPe Domain Coordinates for d1sfka_ are not available.

Timeline for d1sfka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfkb_, d1sfkc_, d1sfkd_, d1sfke_, d1sfkf_, d1sfkg_, d1sfkh_