![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (1 family) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.1: SNARE fusion complex [58039] (11 proteins) |
![]() | Protein Syntaxin 1A [88908] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries) Uniprot P32851 196-259 a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B |
![]() | Domain d1sfcj_: 1sfc J: [45652] Other proteins in same PDB: d1sfca_, d1sfcc_, d1sfcd_, d1sfce_, d1sfcg_, d1sfch_, d1sfci_, d1sfck_, d1sfcl_ complex with synaptobrevin and SNAP-25 fragments complexed with mpd, sr |
PDB Entry: 1sfc (more details), 2.4 Å
SCOPe Domain Sequences for d1sfcj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfcj_ h.1.15.1 (J:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]} siskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyve ravsdtkkavkyqs
Timeline for d1sfcj_: